Recombinant Mouse IL-27A Protein
Product Sizes
10 ug
£145.00
RP01898-10UG
20 ug
£193.00
RP01898-20UG
50 ug
£288.00
RP01898-50UG
100 ug
£431.00
RP01898-100UG
About this Product
- SKU:
- RP01898
- Additional Names:
- IL-27|IL-27 p28|IL-27A|IL-27p28|IL-30|IL27|IL27 p28|IL27A|IL27p28|IL30|p28
- Extra Details:
- Recombinant Mouse IL-27 p28/IL-30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Ser234) of Human Mouse IL-27 p28/IL-30 (Accession #NP_663611.1) fused with a His at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Phe29-Ser234
- Molecular Weight:
- 24.26 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01898
