Recombinant Rat Sonic hedgehog N-product/SHH Protein
Product Sizes
10 ug
£145.00
RP01896-10UG
20 ug
£193.00
RP01896-20UG
50 ug
£288.00
RP01896-50UG
100 ug
£431.00
RP01896-100UG
About this Product
- SKU:
- RP01896
- Additional Names:
- Shh, Vhh-1, Sonic hedgehog protein, SHH, 3.1.-.-, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC, Cleaved into: Sonic hedgehog protein N-product, ShhN, Shh N-terminal processed signaling domains, ShhNp
- Extra Details:
- Recombinant Rat Sonic hedgehog N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of Rat Sonic hedgehog /SHH (Accession #NP_058917.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala24-Gly198
- Molecular Weight:
- 20.53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01896
