Recombinant Human EREG Protein
Product Sizes
10 ug
£133.00
RP01895-10UG
20 ug
£181.00
RP01895-20UG
50 ug
£240.00
RP01895-50UG
100 ug
£353.00
RP01895-100UG
About this Product
- SKU:
- RP01895
- Additional Names:
- EREG,Proepiregulin, Cleaved into: Epiregulin, EPR
- Extra Details:
- Recombinant Human EREG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val63-Leu108) of Human EREG (Accession #NP_001423.1) fused with a hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val63-Leu108
- Molecular Weight:
- 31.23 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01895
