Recombinant Rat Follistatin/FST Protein
Product Sizes
10 ug
£193.00
RP01893-10UG
20 ug
£258.00
RP01893-20UG
50 ug
£383.00
RP01893-50UG
100 ug
£586.00
RP01893-100UG
About this Product
- SKU:
- RP01893
- Additional Names:
- Fst,Follistatin, FS, Activin-binding protein
- Extra Details:
- Recombinant Rat Follistatin/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Trp344) of Rat Follistatin/FST (Accession #NP_036693.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Trp344
- Molecular Weight:
- 38.68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01893
