Recombinant Rat Follistatin/FST Protein
Product Sizes
10 ug
£193.00
RP01893-10UG
20 ug
£258.00
RP01893-20UG
50 ug
£383.00
RP01893-50UG
100 ug
£586.00
RP01893-100UG
500 ug
£1716.00
RP01893-500UG
1000 ug
£2716.00
RP01893-1000UG
About this Product
- SKU:
- RP01893
- Additional Names:
- Fst,Follistatin, FS, Activin-binding protein
- Extra Details:
- Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation; negative regulation of transcription by RNA polymerase II; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development; keratinocyte proliferation; and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).
- Formulation:
- Recombinant Rat Follistatin/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Trp344) of Rat Follistatin/FST (Accession #NP_036693.1) fused
- Immunogen:
- Met1-Trp344
- Molecular Weight:
- 45-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01893
