Recombinant Mouse IL-19 Protein
Product Sizes
10 ug
£145.00
RP01890-10UG
20 ug
£193.00
RP01890-20UG
50 ug
£288.00
RP01890-50UG
100 ug
£431.00
RP01890-100UG
About this Product
- SKU:
- RP01890
- Additional Names:
- IL-10C|IL-19|IL19|interleukin 19|MDA1|melanoma differentiation associated protein-like protein|NG.1Melanoma differentiation-associated protein-like protein|ZMDA1interleukin-19
- Extra Details:
- Recombinant Mouse IL-19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala176) of Mouse IL-19 (Accession #NP_001009940.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu25-Ala176
- Molecular Weight:
- 18.45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01890
