Recombinant Mouse IGF-I Protein
Product Sizes
10 ug
£127.00
RP01887-10UG
20 ug
£157.00
RP01887-20UG
50 ug
£223.00
RP01887-50UG
100 ug
£336.00
RP01887-100UG
500 ug
£937.00
RP01887-500UG
1000 ug
£1478.00
RP01887-1000UG
About this Product
- SKU:
- RP01887
- Additional Names:
- Igf1, Igf-1,Insulin-like growth factor I, IGF-I, Somatomedin
- Extra Details:
- Insulin-like growth factor I, also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Mouse IGF-I/IGF-1 is synthesized as two precursor isoforms with alternate N- and C-terminal propeptides . These isoforms are differentially expressed by various tissues. The 7.6 kDa mature IGF-I/IGF-1 is identical between isoforms and is generated by proteolytic removal of the N- and C-terminal regions. Mature mouse IGF-I/IGF-1 shares 94% and 99% aa sequence identity with human and rat IGF-I/IGF-1, respectively, and exhibits cross-species activity. It shares 60% aa sequence identity with mature mouse IGF-II/IGF-2. Circulating IGF-I/IGF-1 is produced by hepatocytes, while local IGF-I is produced by many other tissues in which it has paracrine effects . IGF-I induces the proliferation, migration, and differentiation of a wide variety of cell types during development and postnatally . IGF-I regulates glucose and fatty acid metabolism, steroid hormone activity, and cartilage and bone metabolism . It plays an important role in muscle regeneration and tumor progression. IGF-I binds IGF-I R, IGF-II R, and the insulin receptor, although its effects are mediated primarily by IGF-I R. IGF-I association with IGF binding proteins increases its plasma half-life and modulates its interactions with receptors.
- Formulation:
- Recombinant Mouse IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly49-Ala118) of Mouse IGF-I (Accession #NP_001104745.1) fused with a hFc
- Immunogen:
- Gly49-Ala118
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01887
