Recombinant Mouse CCL21/6Ckine Protein
Product Sizes
10 ug
£145.00
RP01885-10UG
20 ug
£193.00
RP01885-20UG
50 ug
£288.00
RP01885-50UG
100 ug
£431.00
RP01885-100UG
About this Product
- SKU:
- RP01885
- Additional Names:
- 6Ckine|Beta-Chemokine Exodus-2|C-C Motif Chemokine 21a|Ccl21a|Scya21|Scya21a|Small-Inducible Cytokine A21a|TCA4|Thymus-Derived Chemotactic Agent 4
- Extra Details:
- Recombinant Mouse CCL21A Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Gly133) of Mouse CCL21A (Accession #P84444) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser24-Gly133
- Molecular Weight:
- 12.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01885




