Recombinant Mouse CXCL2/MIP-2 Protein
Product Sizes
10 ug
£145.00
RP01882-10UG
20 ug
£193.00
RP01882-20UG
50 ug
£288.00
RP01882-50UG
100 ug
£431.00
RP01882-100UG
500 ug
£1240.00
RP01882-500UG
1000 ug
£1954.00
RP01882-1000UG
About this Product
- SKU:
- RP01882
- Additional Names:
- Cxcl2, Mip-2, Mip2, Scyb2,C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2
- Extra Details:
- Macrophage Inflammatory Protein-2 (MIP-2) was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. Based on its protein and DNA sequences, MIP-2 is a member of the alpha (C-X-C) subfamily of chemokines. MIP-2 cDNA encodes a 100 amino acid residue precursor protein from which the amino-terminal 27 amino acid residues are cleaved to generate the mature MIP-2. The protein sequence of murine MIP-2 shows approximately 63% identity to that of murine KC, another murine alpha chemokine whose expression is induced by PDGF. In addition, the protein sequence of MIP-2 is also 60% identical to human GRO beta and GRO gamma. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs. Similarly to other alpha chemokines, murine MIP-2 is a potent neutrophil attractant and activator. MIP-2 and KC can bind the murine interleukin 8 type B receptor homologue with high affinity. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.
- Formulation:
- Recombinant Mouse CXCL2/MIP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala28-Asn100) of Mouse CXCL2/MIP-2 (Accession #NP_033166.1) fused with a H
- Immunogen:
- Ala28-Asn100
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01882
