Recombinant Mouse IGF-II Protein
Product Sizes
10 ug
£127.00
RP01881-10UG
20 ug
£157.00
RP01881-20UG
50 ug
£223.00
RP01881-50UG
100 ug
£336.00
RP01881-100UG
About this Product
- SKU:
- RP01881
- Additional Names:
- C11orf43|chromosome 11 open reading frame 43|FLJ22066|FLJ44734|GRDF|IGF-2|IGF-II|IGF2|IGFII|insulin-like growth factor 2 (somatomedin A)|insulin-like growth factor II|insulin-like growth factor type 2|MSA|PEG2|PP9974|somatomedin-A
- Extra Details:
- Recombinant Mouse IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of Mouse IGF-II (Accession #NP_001116208.1) fused with a hFc at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala25-Glu91
- Molecular Weight:
- 33.35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01881
