Recombinant Human NKG-2D/KLRK1/CD314 Protein
Product Sizes
10 ug
£133.00
RP01879-10UG
20 ug
£181.00
RP01879-20UG
50 ug
£240.00
RP01879-50UG
100 ug
£353.00
RP01879-100UG
500 ug
£1002.00
RP01879-500UG
1000 ug
£1574.00
RP01879-1000UG
About this Product
- SKU:
- RP01879
- Additional Names:
- CD314|KLR|NKG2-D|NKG2D
- Extra Details:
- NKG2D is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors, also known as KLRK1, CD314, D12S2489E, KLR and killer cell lectin like receptor K1. NKG2D itself forms a homodimer whose ectodomains serve for ligand binding. NKG2D is a major recognition receptor for the detection and elimination of transformed and infected cells as its ligands are induced during cellular stress, either as a result of infection or genomic stress such as in cancer. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity. The function of NKG2D on CD8+ T cells is to send co-stimulatory signals to activate them.
- Formulation:
- Recombinant Human NKG-2D/KLRK1/CD314 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (ILe73-Val216) of Human NKG-2D/KLRK1/CD314 (Accession #NP_0011
- Immunogen:
- ILe73-Val216
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01879
