Recombinant Human IGF-II Protein
Product Sizes
10 ug
£127.00
RP01878-10UG
20 ug
£157.00
RP01878-20UG
50 ug
£223.00
RP01878-50UG
100 ug
£336.00
RP01878-100UG
500 ug
£907.00
RP01878-500UG
1000 ug
£1478.00
RP01878-1000UG
About this Product
- SKU:
- RP01878
- Additional Names:
- IGF2,C11orf43,GRDF,IGF-II,PP9974
- Extra Details:
- This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Recombinant Human IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344)fused with a hFc tag at the
- Immunogen:
- (Ala25-Glu91)
- Molecular Weight:
- 40-45 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01878
