Recombinant Human IGF-II Protein
Product Sizes
10 ug
£127.00
RP01878-10UG
20 ug
£157.00
RP01878-20UG
50 ug
£223.00
RP01878-50UG
100 ug
£336.00
RP01878-100UG
About this Product
- SKU:
- RP01878
- Additional Names:
- IGF2,C11orf43,GRDF,IGF-II,PP9974
- Extra Details:
- Recombinant Human IGF-II Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Glu91) of human IGF2 (Accession #P01344)fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 50mMTris, 100mM Glycine, pH7.5.
- Immunogen:
- (Ala25-Glu91)
- Molecular Weight:
- 33.44 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01878
