Recombinant Mouse CXCL12/SDF-1 Protein
Product Sizes
10 ug
£145.00
RP01877-10UG
20 ug
£193.00
RP01877-20UG
50 ug
£288.00
RP01877-50UG
About this Product
- SKU:
- RP01877
- Additional Names:
- 12-O-tetradecanoylphorbol 13-acetate repressedprotein 1|C-X-C motif chemokine 12|Cxcl12|PBSF|Pre-B cell growth-stimulating factor|SDF-1|Sdf1|Stromal cell-derived factor 1|Thymiclymphoma cell-stimulating factor|TLSF|TPAR1
- Extra Details:
- Recombinant Mouse CXCL12/SDF-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys22-Lys89) of mouse CXCL12/SDF-1 alpha (Accession #P40224) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Lys22-Lys89
- Molecular Weight:
- 7.98 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01877
