Recombinant Mouse CXCL12/SDF-1 Protein
Product Sizes
10 ug
£145.00
RP01877-10UG
20 ug
£193.00
RP01877-20UG
50 ug
£288.00
RP01877-50UG
500 ug
£1240.00
RP01877-500UG
1000 ug
£1954.00
RP01877-1000UG
About this Product
- SKU:
- RP01877
- Additional Names:
- 12-O-tetradecanoylphorbol 13-acetate repressedprotein 1|C-X-C motif chemokine 12|Cxcl12|PBSF|Pre-B cell growth-stimulating factor|SDF-1|Sdf1|Stromal cell-derived factor 1|Thymiclymphoma cell-stimulating factor|TLSF|TPAR1
- Extra Details:
- Mouse Cxcl12 is a secreted and highly conserved protein which belongs to the intercrine alpha (chemokine CxC)family.CXCL12 is widely expressed in various organs including brain, kidney, skeletal muscle, heart, liver, and lymphoidorgans. Cxcl12 activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level ofintracellular calcium ions and chemotaxis. It also binds to atypical chemokine receptor ACKR3 which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Cxcl12 has several critical functions during embryonicdevelopment such as B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Cxcl12plays an important role in acting as a positive regulator of monocyte migration and a negative regulator of monocyteadhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 andACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. It also plays aprotective role after myocardial infarction, induces down-regulation and internalization of ACKR3 expressed in various cellsand stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of thestromal cell-dependent B-cell clone DW34 cells.
- Formulation:
- Recombinant Mouse CXCL12/SDF-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys22-Lys89) of mouse CXCL12/SDF-1 alpha (Accession #P40224) fused with n
- Immunogen:
- Lys22-Lys89
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01877
