Recombinant Mouse RETN Protein
Product Sizes
10 ug
£133.00
RP01873-10UG
20 ug
£181.00
RP01873-20UG
50 ug
£240.00
RP01873-50UG
100 ug
£353.00
RP01873-100UG
500 ug
£1002.00
RP01873-500UG
1000 ug
£1574.00
RP01873-1000UG
About this Product
- SKU:
- RP01873
- Additional Names:
- Resistin, Adipose tissue-specific secretory factor, ADSF, Adipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3, Retn, Fizz3
- Extra Details:
- Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.
- Formulation:
- Recombinant Mouse RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Ser114 ) of Mouse RETN (Accession #NP_075360.1) fused with hFc tag at
- Immunogen:
- Ser21-Ser114
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01873
