Recombinant Human CD81 Protein
Product Sizes
10 ug
£133.00
RP01871-10UG
20 ug
£181.00
RP01871-20UG
50 ug
£240.00
RP01871-50UG
100 ug
£353.00
RP01871-100UG
About this Product
- SKU:
- RP01871
- Additional Names:
- CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28, Tspan-28, CD81, CD81, TAPA1, TSPAN28
- Extra Details:
- Recombinant Human CD81 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe113-Lys201 ) of Human CD81 (Accession #NP_004347.1) fused with hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Phe113-Lys201
- Molecular Weight:
- 35.73 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01871
