Recombinant Human C1QC Protein
Product Sizes
20 ug
£181.00
RP01865-20UG
100 ug
£353.00
RP01865-100UG
About this Product
- SKU:
- RP01865
- Additional Names:
- C1Q-C|C1QD3|C1QG|Complement C1q subcomponent subunit C
- Extra Details:
- Recombinant HumanC1QC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn29-Asp245) of human ENPP-1 (Accession #P02747) fused with 6xHis and hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asn29-Asp245
- Molecular Weight:
- 49.60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01865
