Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein

Product Sizes
10 ug
£145.00
RP01864-10UG
20 ug
£193.00
RP01864-20UG
50 ug
£264.00
RP01864-50UG
100 ug
£395.00
RP01864-100UG
500 ug
£1157.00
RP01864-500UG
1000 ug
£1812.00
RP01864-1000UG
About this Product
SKU:
RP01864
Additional Names:
Cd70, Cd27l, Cd27lg, Tnfsf7, CD70 antigen, CD27 ligand, CD27-L, Tumor necrosis factor ligand superfamily member 7, CD70.
Extra Details:
CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells. As for CD70 protein in mouse contains TNF_2 domain (60-190 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 (CD27 Ligand) belongs to the tumor necrosis factor (TNF) family, is the ligand for TNFRSF27/CD27. CD70 and CD27 are homotrimer type II and homodimer type I transmembrane glycoprotein, expressing on activated and resting T and B lymphocytes, respectively. As for a wildly use of CD70 in animal disease model, the sequence of amino acids in mouse is very different from human (56.25%) and rat (77.20%). CD70 as one of the most frequently mutated genes in a series of diffuse large B cell lymphomas, especially acts in a crucial Epstein-Barr virus (EBV)-specific T cell immunity and more generally for the immune surveillance of B cells. CD70 inhibits EBV infection by restoring the expansion of EBV-specific T lymphocytes stimulated by the CD70-deficient EBV-infected B cells. CD70 involves in activation of innate and adaptive immunity, expressing in the mature dendritic cells and being up-regulated upon the triggering of CD40 or Toll-like receptors. CD70 induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. CD70 is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. targeting CD70 positive tumors with CAR-T cells induces a potent antitumor response.
Formulation:
Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu53-Arg195) of Mouse CD70/TNFSF7/CD27 Ligand (A
Immunogen:
Glu53-Arg195
Molecular Weight:
25-30 kDa
Physical State:
Lyophilized
Purity:
≥90%
Sequence:
EHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQR
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
ABclonal Technology
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins