Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein
Product Sizes
10 ug
£145.00
RP01864-10UG
20 ug
£193.00
RP01864-20UG
50 ug
£264.00
RP01864-50UG
100 ug
£395.00
RP01864-100UG
About this Product
- SKU:
- RP01864
- Additional Names:
- Cd70, Cd27l, Cd27lg, Tnfsf7, CD70 antigen, CD27 ligand, CD27-L, Tumor necrosis factor ligand superfamily member 7, CD70.
- Extra Details:
- Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu53-Arg195) of Mouse CD70/TNFSF7/CD27 Ligand (Accession #NP_035747.1) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu53-Arg195
- Molecular Weight:
- 12.48 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- EHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01864
