Recombinant Mouse IL-6RA/CD126 Protein
Product Sizes
10 ug
£145.00
RP01862-10UG
20 ug
£193.00
RP01862-20UG
50 ug
£288.00
RP01862-50UG
100 ug
£431.00
RP01862-100UG
500 ug
£1240.00
RP01862-500UG
1000 ug
£1954.00
RP01862-1000UG
About this Product
- SKU:
- RP01862
- Additional Names:
- CD126|IL-6 receptor subunit alpha|IL-6R subunit alpha|IL-6R-alpha|IL-6RA|Il6r|Il6ra
- Extra Details:
- IL-6R alpha (IL-6RA) is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6RA is a type I transmembrane glycoprotein, which forms a complex with the type I transmembrane signal transducer Glycoprotein 130 (CD130) and regulates the biological activity of IL-6 with a low affinity. IL-6RA acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway. IL-6RA has 2 isoform including mIL-6R (the longer one) or sIL-6R (the shorter one): The mIL-6R is membrane-bound interleukin-6 receptor, has the potential to drive naive CD4+ T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells. The sIL-6R is soluble interleukin-6 receptor subunit, cleaved from IL-6RA in activated CD4+ T cells by proteolysis, and serves as IL-6 agonist. sIL-6R binds membrane-bound IL-6R and subunit IL6ST to activate regenerative and anti-inflammatory signal via IL-6 trans signaling and promotes pro-inflammatory properties of IL-6. The hydrolysis of IL-6R alpha is also called ectodomain shedding. IL-6RA involves in regulating cell growth and differentiation, and plays an important role in regulation of immune response, acute-phase reactions and hematopoiesis. However, IL-6RA shows tissue expression specificity in liver and some cells of the immune system, thus results a limitation of IL6 signaling. It's worth noting that IL-6RA dysregulation is implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases, and prostate cancer.
- Formulation:
- Recombinant Mouse IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 20 - Glu 357) of Mouse Il6ra (Accession #NP_034689.2) fused wit
- Immunogen:
- Leu 20 - Glu 357
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01862
