Recombinant Mouse IL-6RA/CD126 Protein
Product Sizes
10 ug
£145.00
RP01862-10UG
20 ug
£193.00
RP01862-20UG
50 ug
£288.00
RP01862-50UG
100 ug
£431.00
RP01862-100UG
About this Product
- SKU:
- RP01862
- Additional Names:
- CD126|IL-6 receptor subunit alpha|IL-6R subunit alpha|IL-6R-alpha|IL-6RA|Il6r|Il6ra
- Extra Details:
- Recombinant Mouse IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 20 - Glu 357) of Mouse Il6ra (Accession #NP_034689.2) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu 20 - Glu 357
- Molecular Weight:
- 38.27 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01862
