Recombinant Rat ALK-4/ACVR1B Protein
Product Sizes
10 ug
£145.00
RP01861-10UG
20 ug
£193.00
RP01861-20UG
50 ug
£288.00
RP01861-50UG
100 ug
£431.00
RP01861-100UG
About this Product
- SKU:
- RP01861
- Additional Names:
- Activin receptor type-1B, 2.7.11.30, Activin receptor type IB, ACTR-IB, Activin receptor-like kinase 4, ALK-4, Serine/threonine-protein kinase receptor R2, SKR2, Acvr1b, Acvrlk4, Alk4
- Extra Details:
- Recombinant Rat ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu126 ) of Rat ALK-4/ACVR1B (Accession #NP_954700.1) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Glu126
- Molecular Weight:
- 41.35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPEHPSMWGPVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01861
