Recombinant Mouse IGF-I Protein
Product Sizes
10 ug
£127.00
RP01859-10UG
20 ug
£157.00
RP01859-20UG
50 ug
£223.00
RP01859-50UG
About this Product
- SKU:
- RP01859
- Additional Names:
- Insulin-like growth factor I, IGF-I, Somatomedin, Igf1, Igf-1
- Extra Details:
- Recombinant Mouse IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly49-Ala118) of Mouse IGF-I (Accession #NP_001104745.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly49-Ala118
- Molecular Weight:
- 33.64 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01859
