Recombinant Rat Erythropoietin/EPO Protein
Product Sizes
10 ug
£163.00
RP01858-10UG
20 ug
£223.00
RP01858-20UG
50 ug
£336.00
RP01858-50UG
100 ug
£508.00
RP01858-100UG
500 ug
£1478.00
RP01858-500UG
1000 ug
£2335.00
RP01858-1000UG
About this Product
- SKU:
- RP01858
- Additional Names:
- Erythropoietin, Epo
- Extra Details:
- Erythropoietin (EPO), originally identified for its critical hormonal role in promoting erythrocyte survival and differentiation, is a member of the large and diverse cytokine superfamily. EPO and EPOR function as the primary mediators of a general protective response to tissue hypoxia, which acts to maintain adequate tissue oxygenation through adjustments of circulating red cell mass by using a hormonal feedback-control system involving the kidney and the bone marrow. EPO and EPORs are also expressed by other tissues and organs, including the brain and heart. EPO has also been shown to stimulate mitosis and signaling in astrocytes, endothelial cells, cardiomyoblasts, and cardiomyocytes maintained in vitro
- Formulation:
- Recombinant Rat Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg192) of Rat Erythropoietin/EPO (Accession #NP_058697.1
- Immunogen:
- Ala27-Arg192
- Molecular Weight:
- 30-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01858
