Recombinant Human CXCL2/MIP-2 Protein
Product Sizes
10 ug
£145.00
RP01857-10UG
20 ug
£193.00
RP01857-20UG
50 ug
£288.00
RP01857-50UG
100 ug
£431.00
RP01857-100UG
500 ug
£1240.00
RP01857-500UG
1000 ug
£1954.00
RP01857-1000UG
About this Product
- SKU:
- RP01857
- Additional Names:
- CXCL2, GRO2, GROB, MIP2A, SCYB2,C-X-C motif chemokine 2, Growth-regulated protein beta, Gro-beta, Macrophage inflammatory protein 2-alpha, MIP2-alpha, Cleaved into: GRO-beta(5-73), GRO-beta-T, Hematopoietic synergistic factor, HSF, SB-251353
- Extra Details:
- CXCL2 is a chemokine induced by endotoxin and serves as an extremely potent chemo-attractant for neutrophils, acting as a crucial inflammatory mediator. CXCL2 could be produced by multiple, different cell types, including macrophages and cancer cells. CXCL2 is involved in cancer metastasis, angiogenesis, and wound healing. The amino acid sequence of human CXCL2 protein has low homology between mouse and rat CXCL2 protein. CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 binds to the G-protein coupled receptor CXCR2 (IL-8RB) expressed on macrophages, neutrophils, and epithelial cells and its classical function is to act as chemotactic factors attracting neutrophils to sites of injury. In enterocytes, LPS induces CXCL2 expression and promotes migration of neutrophils in a model of platelet-activating factor induced shock and bowel injury. In acute lung injury, CXCR2 ligands, including CXCL1/2/3, have chemotactic effects for polymorphonuclear leukocytes. CXCL2 could provoke a dose-dependent increase of colorectal tumor cell migration in vitro. Further, according to Bachmeier et al., CXCL-1 and -2 silencing could down-regulate several metastasis-promoting genes and inhibit the metastatic potential of breast cancer cells.
- Formulation:
- Recombinant Human CXCL2/MIP-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of Human CXCL2/MIP-2 (Accession #NP_002080.1) fused with No
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01857
