Recombinant Human CXCL2/MIP-2 Protein
Product Sizes
10 ug
£145.00
RP01857-10UG
20 ug
£193.00
RP01857-20UG
50 ug
£288.00
RP01857-50UG
100 ug
£431.00
RP01857-100UG
About this Product
- SKU:
- RP01857
- Additional Names:
- CXCL2, GRO2, GROB, MIP2A, SCYB2,C-X-C motif chemokine 2, Growth-regulated protein beta, Gro-beta, Macrophage inflammatory protein 2-alpha, MIP2-alpha, Cleaved into: GRO-beta(5-73), GRO-beta-T, Hematopoietic synergistic factor, HSF, SB-251353
- Extra Details:
- Recombinant Human CXCL2/MIP-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of Human CXCL2/MIP-2 (Accession #NP_002080.1) fused with No tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mMTris,500mMNaCl,pH8.0
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 7.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01857




