Recombinant Human CCL3/MIP-1 alpha Protein
Product Sizes
10 ug
£145.00
RP01855-10UG
20 ug
£193.00
RP01855-20UG
50 ug
£288.00
RP01855-50UG
100 ug
£431.00
RP01855-100UG
About this Product
- SKU:
- RP01855
- Additional Names:
- CCL3, G0S19-1, MIP1A, SCYA3,C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein, Cleaved into: MIP-1-alpha(4-69), LD78-alpha(4-69)
- Extra Details:
- Recombinant Human CCL3/MIP-1 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ala92 ) of Human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala23-Ala92
- Molecular Weight:
- 7.78 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01855
