Recombinant Mouse TIMP-1 Protein
Product Sizes
10 ug
£163.00
RP01853-10UG
20 ug
£223.00
RP01853-20UG
50 ug
£336.00
RP01853-50UG
100 ug
£508.00
RP01853-100UG
500 ug
£1478.00
RP01853-500UG
1000 ug
£2335.00
RP01853-1000UG
About this Product
- SKU:
- RP01853
- Additional Names:
- Metalloproteinase inhibitor 1, Collagenase inhibitor 16C8 fibroblast, Erythroid-potentiating activity, EPA, TPA-S1, TPA-induced protein, Tissue inhibitor of metalloproteinases 1, TIMP-1, Timp1, Timp, Timp-1
- Extra Details:
- TIMP metallopeptidase inhibitor 1 is also known as TIMP1, a tissue inhibitor of metalloproteinases, is a glycoprotein that is expressed from the several tissues of organisms. This protein a member of the TIMP family.There are four members of the family, TIMP1,TIMP2,TIMP3 and TIMP4. TIMP1 is a glycoprotein with a molecular mass of 28 kDa produced by a wide range of cell types. The glycoprotein is a natural inhibitor of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction.
- Formulation:
- Recombinant Mouse TIMP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys25-Arg205 ) of Mouse TIMP-1 (Accession #NP_035723.2) fused with His ta
- Immunogen:
- Cys25-Arg205
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01853
