Recombinant Mouse TIMP-1 Protein
Product Sizes
10 ug
£163.00
RP01853-10UG
20 ug
£223.00
RP01853-20UG
50 ug
£336.00
RP01853-50UG
100 ug
£508.00
RP01853-100UG
About this Product
- SKU:
- RP01853
- Additional Names:
- Metalloproteinase inhibitor 1, Collagenase inhibitor 16C8 fibroblast, Erythroid-potentiating activity, EPA, TPA-S1, TPA-induced protein, Tissue inhibitor of metalloproteinases 1, TIMP-1, Timp1, Timp, Timp-1
- Extra Details:
- Recombinant Mouse TIMP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys25-Arg205 ) of Mouse TIMP-1 (Accession #NP_035723.2) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Cys25-Arg205
- Molecular Weight:
- 21.08 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01853
