Recombinant Rat IL-5 Protein
Product Sizes
10 ug
£163.00
RP01849-10UG
20 ug
£223.00
RP01849-20UG
50 ug
£336.00
RP01849-50UG
100 ug
£508.00
RP01849-100UG
500 ug
£1478.00
RP01849-500UG
1000 ug
£2335.00
RP01849-1000UG
About this Product
- SKU:
- RP01849
- Additional Names:
- Interleukin-5, IL-5, B-cell growth factor II, BCGF-II, Cytotoxic T-lymphocyte inducer, Eosinophil differentiation factor, T-cell replacing factor, TRF, Il5, Il-5
- Extra Details:
- Interleukin-5 (IL-5), which is produced primarily by type 2 T helper lymphocytes (Th2), is an eosinophil differentiation and activation factor. Antagonism of IL-5 activity is being explored as a potential treatment of a number of disease conditions associated with eosinophils in animal models. Interleukin-5 (IL-5) which was previously named T cell replacing factor, B cell growth and differentiation factor, colony forming unit growth stimulating factor and eosinophil differentiation factor is produced predominantly by T cells.
- Formulation:
- Recombinant Rat IL-5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met20-Val132) of Rat IL-5 (Accession #NP_068606.1 ) fused with a His tag at t
- Immunogen:
- Met20-Val132
- Molecular Weight:
- 20-30 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01849
