Recombinant Mouse FGF-10 Protein
Product Sizes
10 ug
£163.00
RP01848-10UG
20 ug
£223.00
RP01848-20UG
50 ug
£336.00
RP01848-50UG
100 ug
£508.00
RP01848-100UG
About this Product
- SKU:
- RP01848
- Additional Names:
- Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,Fgf10
- Extra Details:
- Recombinant Mouse FGF-10 Protein is produced by E. coli expression systerm. The target protein is expressed with sequence (Gln37-Thr209) of Mouse FGF-10 (Accession #NP_032028.1) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mMPB,800mMNaCl, pH7.4
- Immunogen:
- Gln37-Thr209
- Molecular Weight:
- 19.54 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01848




