Recombinant Rat CSF-1/M-CSF Protein
Product Sizes
10 ug
£145.00
RP01847-10UG
20 ug
£193.00
RP01847-20UG
50 ug
£288.00
RP01847-50UG
100 ug
£431.00
RP01847-100UG
500 ug
£1478.00
RP01847-500UG
1000 ug
£2335.00
RP01847-1000UG
About this Product
- SKU:
- RP01847
- Additional Names:
- Macrophage colony-stimulating factor 1, CSF-1, MCSF, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF, Cleaved into: Processed macrophage colony-stimulating factor 1, Macrophage colony-stimulating factor 1 43 kDa subunit, Csf1, Csfm
- Extra Details:
- Macrophage colony-stimulating factor (M-CSF), also known as colony-stimulating factor-1 (CSF-1), is a hemopoietic growth factor that regulates the survival, proliferation, differentiation and function of the cells of the mononuclear phagocyte lineage. M-CSF is produced by a variety of cell types and acts both locally and humorally in an autocrine and paracrine manner. Through differential mRNA splicing and posttranslational proteolytic processing and modification, M-CSF is expressed in three biologically-active isoforms: a secreted glycoprotein; a secreted proteoglycan; and a membrane spanning cell-surface glycoprotein.
- Formulation:
- Recombinant Rat CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ser255) of Rat CSF-1/M-CSF (Accession #NP_076471.3 ) fused with a
- Immunogen:
- Met1-Ser255
- Molecular Weight:
- 40-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PSSTWMGSRLLLVCLLVSRSVAEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01847
