Recombinant Mouse TGF-alpha Protein
Product Sizes
10 ug
£145.00
RP01846-10UG
20 ug
£193.00
RP01846-20UG
About this Product
- SKU:
- RP01846
- Additional Names:
- Protransforming growth factor alpha, Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1, Tgfa
- Extra Details:
- Recombinant Mouse TGF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala38-Ala88) of Mouse TGF-alpha/TGFA (Accession #NP_112476.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala38-Ala88
- Molecular Weight:
- 32.08 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- SPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01846
