Recombinant Human Gastrin-releasing peptide/GRP Protein
Product Sizes
10 ug
£145.00
RP01845-10UG
20 ug
£193.00
RP01845-20UG
50 ug
£288.00
RP01845-50UG
100 ug
£431.00
RP01845-100UG
About this Product
- SKU:
- RP01845
- Additional Names:
- BN|Gastrin-releasing peptide|GRP|GRP-10|preproGRP|progastrin-releasing peptide|proGRP
- Extra Details:
- Recombinant Human Gastrin-releasing peptide/GRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg22-Gly148) of human Gastrin-releasing peptide/GRP (Accession #) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg22-Gly148
- Molecular Weight:
- 39.90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- RAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP01845
