Recombinant Human CXCL1/GRO-alpha Protein
Product Sizes
10 ug
£145.00
RP01841-10UG
20 ug
£193.00
RP01841-20UG
50 ug
£288.00
RP01841-50UG
100 ug
£431.00
RP01841-100UG
About this Product
- SKU:
- RP01841
- Additional Names:
- CXCL1, GRO, GRO1, GROA, MGSA, SCYB1,Growth-regulated alpha protein, C-X-C motif chemokine 1, GRO-alpha(1-73), Melanoma growth stimulatory activity, MGSA, Neutrophil-activating protein 3, NAP-3, Cleaved into: GRO-alpha(4-73), GRO-alpha(5-73), GRO-alpha(6-73)
- Extra Details:
- Recombinant Human CXCL1/GRO-alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence ( Ala35-Asn107) of Human CXCL1/GRO-alpha (Accession #NP_001502.1) fused with No-tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 7.86 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01841
