Recombinant Mouse FGF-9 Protein
Product Sizes
10 ug
£145.00
RP01840LQ-10UG
20 ug
£193.00
RP01840LQ-20UG
50 ug
£288.00
RP01840LQ-50UG
100 ug
£431.00
RP01840LQ-100UG
500 ug
£1265.00
RP01840LQ-500UG
1000 ug
£1979.00
RP01840LQ-1000UG
About this Product
- SKU:
- RP01840LQ
- Additional Names:
- Fibroblast growth factor 9, FGF-9, Glia-activating factor, GAF, HBGF-9, Fgf9, Fgf-9
- Extra Details:
- Fibroblast growth factor 9 is also known as FGF9, GAF, HBFG-9, SYNS3, and is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF9 is also a mitogen for oligodendrocyte type 2 astrocyte progenitor cells, smooth muscle cells, pheochromocytoma PC12 cells, and BALB/3T3 fibroblasts. However, unlike FGF acidic and basic, FGF9 has no effect on human umbilical vein endothelial cells, and it has been demonstrated that FGF9 binds preferentially to the IIIc form of FGFR3. Although no typical signal sequence was found in FGF9, it is secreted efficiently after synthesis not in a conventional manner. In nervous system, FGF9 is produced mainly by neurons and may plays an important role in CNS development. FGF9 has been shown to interact with Fibroblast growth factor receptor 3.
- Formulation:
- Recombinant Mouse FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of Mouse FGF-9 (Accession #NP_038546.2) fused with NO-tag.
- Immunogen:
- Met1-Ser208
- Molecular Weight:
- 25-30 kDa
- Purity:
- ≥90%
- Sequence:
- MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01840LQ
