Recombinant Mouse FGF-9 Protein
Product Sizes
10 ug
£145.00
RP01840LQ-10UG
20 ug
£193.00
RP01840LQ-20UG
50 ug
£288.00
RP01840LQ-50UG
100 ug
£431.00
RP01840LQ-100UG
About this Product
- SKU:
- RP01840LQ
- Additional Names:
- Fibroblast growth factor 9, FGF-9, Glia-activating factor, GAF, HBGF-9, Fgf9, Fgf-9
- Extra Details:
- Recombinant Mouse FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of Mouse FGF-9 (Accession #NP_038546.2) fused with NO-tag.
- Formulation:
- Supplied as a 0.22 um filtered solution of solution of 20mM Tris-HCl, 250mM NaCl, 1mM EDTA, 20% Glycerol, 1mM DTT, pH 8.5
- Immunogen:
- Met1-Ser208
- Molecular Weight:
- 23.41 kDa
- Purity:
- ≥90%
- Sequence:
- MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01840LQ
