Recombinant Human CCL3L1 Protein
Product Sizes
10 ug
£145.00
RP01834-10UG
20 ug
£193.00
RP01834-20UG
50 ug
£288.00
RP01834-50UG
100 ug
£431.00
RP01834-100UG
About this Product
- SKU:
- RP01834
- Additional Names:
- 464.2|D17S1718|G0S19-2|LD78|LD78-beta(1-70)|LD78BETA|MIP1AP|SCYA3L|SCYA3L1
- Extra Details:
- Recombinant Human CCL3L1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala24-Ala93) of human CCL3L1 (Accession #NP_001001437.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala24-Ala93
- Molecular Weight:
- 8.63 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01834
