Recombinant Human CCL3L1 Protein
Product Sizes
10 ug
£145.00
RP01834-10UG
20 ug
£193.00
RP01834-20UG
50 ug
£288.00
RP01834-50UG
100 ug
£431.00
RP01834-100UG
500 ug
£1240.00
RP01834-500UG
1000 ug
£1954.00
RP01834-1000UG
About this Product
- SKU:
- RP01834
- Additional Names:
- 464.2|D17S1718|G0S19-2|LD78|LD78-beta(1-70)|LD78BETA|MIP1AP|SCYA3L|SCYA3L1
- Extra Details:
- The two human MIP-1 alpha genes arise by duplication/mutation. They code for MIP-1 alpha isoforms CCL3/LD78 alpha and CCL3L1/LD78 beta, which share 94% amino acid (aa) sequence homology. Whereas the human CCL3/LD78 alpha is a single-copy gene, the human CCL3L1/LD78 beta gene copy number varies within the population. Human CCL3L1/LD78 beta cDNA encodes a 93 aa residue precursor with a 23 aa residue signal peptide that is cleaved to generate a 70 aa mature protein. Human CCL3L1/LD78 beta binds and signals through chemokine receptors CCR1 and CCR5. When compared to CCL3/LD78 alpha, CCL3L1/LD78 beta has higher binding affinity to CCR5, which also functions as a coreceptor for HIV-1 entry. The copy number of CCL3L1 is one of several genetic determinants of HIV-1 susceptibility (4).
- Formulation:
- Recombinant Human CCL3L1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala24-Ala93) of human CCL3L1 (Accession #NP_001001437.2) fused with a 6xHis ta
- Immunogen:
- Ala24-Ala93
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01834
