Recombinant Human CCL19/MIP-3 beta Protein
Product Sizes
10 ug
£193.00
RP01832-10UG
20 ug
£258.00
RP01832-20UG
50 ug
£383.00
RP01832-50UG
100 ug
£586.00
RP01832-100UG
About this Product
- SKU:
- RP01832
- Additional Names:
- CCL19|CKb11|ELC|MIP-3 beta|MIP-3b|MIP3B|SCYA19
- Extra Details:
- Recombinant Human CCL19/MIP-3 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly22-Ser98) of human CCL19/MIP-3 beta (Accession #NP_006265.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly22-Ser98
- Molecular Weight:
- 9.64 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01832
