Recombinant Human CCL19/MIP-3 beta Protein

Product Sizes

10 ug

£193.00

RP01832-10UG

20 ug

£258.00

RP01832-20UG

50 ug

£383.00

RP01832-50UG

100 ug

£586.00

RP01832-100UG

500 ug

£1716.00

RP01832-500UG

1000 ug

£2716.00

RP01832-1000UG

About this Product

SKU:: RP01832
Additional Names:: CCL19|CKb11|ELC|MIP-3 beta|MIP-3b|MIP3B|SCYA19
Extra Details:: C-C motif chemokine 19(CCL19) is as known as CK beta-11, ELC, MIP3B and SCYA19. May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Formulation:: Recombinant Human CCL19/MIP-3 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly22-Ser98) of human CCL19/MIP-3 beta (Accession #NP_006265.1)
Immunogen:: Gly22-Ser98
Molecular Weight:: 15-20 kDa
Physical State:: Lyophilized
Purity:: ≥90%
Sequence:: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket