Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein
Product Sizes
10 ug
£133.00
RP01831-10UG
20 ug
£181.00
RP01831-20UG
50 ug
£240.00
RP01831-50UG
100 ug
£353.00
RP01831-100UG
About this Product
- SKU:
- RP01831
- Additional Names:
- ANG-5|Angiopoietin-like 3|ANGPT5|ANGPTL3|ANL3|FHBL2
- Extra Details:
- Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val237-Glu460) of human Angiopoietin-like 3/ANGPTL3 (Accession #NP_055310.1) fused with a 6xHis tag at the
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val237-Glu460
- Molecular Weight:
- 26.96 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01831
