Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein
Product Sizes
10 ug
£133.00
RP01829-10UG
20 ug
£181.00
RP01829-20UG
50 ug
£240.00
RP01829-50UG
100 ug
£353.00
RP01829-100UG
About this Product
- SKU:
- RP01829
- Additional Names:
- DER6|GIF|Glif; Macrophage migration inhibitory factor; MIF
- Extra Details:
- Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro2-Ala115) of mouse Macrophage migration inhibitory factor/MIF (Accession #NP_034928.1)
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM Tris 150mM NaCl pH8.0.
- Immunogen:
- Pro2-Ala115
- Molecular Weight:
- 12.37 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01829




