Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein
Product Sizes
10 ug
£133.00
RP01829-10UG
20 ug
£181.00
RP01829-20UG
50 ug
£240.00
RP01829-50UG
100 ug
£353.00
RP01829-100UG
500 ug
£1002.00
RP01829-500UG
1000 ug
£1574.00
RP01829-1000UG
About this Product
- SKU:
- RP01829
- Additional Names:
- DER6|GIF|Glif; Macrophage migration inhibitory factor; MIF
- Extra Details:
- MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12).
- Formulation:
- Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro2-Ala115) of mouse Macrophage migration
- Immunogen:
- Pro2-Ala115
- Molecular Weight:
- 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01829
