Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein
Product Sizes
10 ug
£145.00
RP01828-10UG
20 ug
£193.00
RP01828-20UG
50 ug
£288.00
RP01828-50UG
100 ug
£431.00
RP01828-100UG
About this Product
- SKU:
- RP01828
- Additional Names:
- AGP1|AGPT|AGPT-1; Angiopoietin-1; ANG-1; ANGPT1|ANG1|HAE5
- Extra Details:
- Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of human Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_001137.2) fused with a 6xHis tag at the
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg277-Phe498
- Molecular Weight:
- 26.58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01828
