Recombinant Human FGF-18 Protein
Product Sizes
100 ug
£ POA
RP01827-100UG
10 ug
£145.00
RP01827-10UG
20 ug
£193.00
RP01827-20UG
50 ug
£288.00
RP01827-50UG
500 ug
£1716.00
RP01827-500UG
1000 ug
£2716.00
RP01827-1000UG
About this Product
- SKU:
- RP01827
- Additional Names:
- FGF-18; FGF18|ZFGF5
- Extra Details:
- Fibroblast growth factor 18 (FGF18) is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that FGF18 is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Experiment datas identified FGF18 as a selective ligand for FGFR3 in limb bud mesenchymal cells, which suppressed proliferation and promoted their differentiation and production of cartilage matrix. FGF18 appears to regulate cell proliferation and differentiation positively in osteogenesis and negatively in chondrogenesis.
- Formulation:
- Recombinant Human FGF-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu28-Ala207) of human FGF-18 (Accession #NP_003853.1) fused with a 6xHis
- Immunogen:
- Glu28-Ala207
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01827
