Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
Product Sizes
10 ug
£133.00
RP01825-10UG
20 ug
£181.00
RP01825-20UG
100 ug
£353.00
RP01825-100UG
About this Product
- SKU:
- RP01825
- Additional Names:
- ARIA|GGF|GGF2|HGL|HRG|HRG1|HRGA|MST131|MSTP131|NDF|NRG1-IT2|NRG1 (Beta1) |Pro-neuregulin-1|SMDF
- Extra Details:
- Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr 176-Lys 246) of human Pro-neuregulin-1/NRG1 (Beta1) (Accession #NP_039250.2) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Thr 176-Lys 246
- Molecular Weight:
- 8.06 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01825
