Recombinant Human Lipocalin-2/NGAL/LCN2 Protein
Product Sizes
10 ug
£133.00
RP01823-10UG
20 ug
£181.00
RP01823-20UG
50 ug
£240.00
RP01823-50UG
100 ug
£353.00
RP01823-100UG
500 ug
£1002.00
RP01823-500UG
1000 ug
£1574.00
RP01823-1000UG
About this Product
- SKU:
- RP01823
- Additional Names:
- 24p3|LCN2|Lipocalin-2|MSFI|NGAL|p25
- Extra Details:
- Lipocalin-2 (LCN2), also known as neutrophil gelatinase-associated lipocalin (NGAL), is a 25 kDa protein belonging to the lipocalin superfamily. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein is a neutrophil gelatinase-associated lipocalin and plays a role in innate immunity by limiting bacterial growth as a result of sequestering iron-containing siderophores. The presence of this protein in blood and urine is an early biomarker of acute kidney injury. This protein is thought to be be involved in multiple cellular processes, including maintenance of skin homeostasis, and suppression of invasiveness and metastasis. Mice lacking this gene are more susceptible to bacterial infection than wild type mice.
- Formulation:
- Recombinant Human Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Gly198) of human Lipocalin-2/NGAL/LCN2 (Accession #N
- Immunogen:
- Gln21-Gly198
- Molecular Weight:
- 55-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01823
