Recombinant Human Gastric inhibitory polypeptide/GIP Protein
Product Sizes
10 ug
£145.00
RP01818-10UG
20 ug
£193.00
RP01818-20UG
50 ug
£288.00
RP01818-50UG
100 ug
£431.00
RP01818-100UG
500 ug
£1240.00
RP01818-500UG
1000 ug
£1954.00
RP01818-1000UG
About this Product
- SKU:
- RP01818
- Additional Names:
- Gastric inhibitory polypeptide|GIP|Incretin
- Extra Details:
- The potential application of glucose-dependent insulinotropic polypeptide (gastric inhibitory polypeptide, GIP) in the management of obesity and type 2 diabetes has been controversial. Initial interest in the therapeutic use of GIP was dampened by evidence that its insulinotropic activity was reduced in type 2 diabetes and by reports that it increased glucagon secretion and adipose deposition in non-diabetic individuals.
- Formulation:
- Recombinant Human GIP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr52-Gln93) of human GIP (Accession #NP_004114.1) fused with a hFc tag at t
- Immunogen:
- Tyr52-Gln93
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP01818
