Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein
Product Sizes
10 ug
£133.00
RP01817-10UG
20 ug
£181.00
RP01817-20UG
50 ug
£240.00
RP01817-50UG
100 ug
£353.00
RP01817-100UG
About this Product
- SKU:
- RP01817
- Additional Names:
- IL-1ra|il1ra
- Extra Details:
- Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (His27-Gln178) of rat IL-1Ra/IL-1F3/IL-1RN (Accession #NP_071530.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- His27-Gln178
- Molecular Weight:
- 17.38 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01817




