Recombinant Human CD320 Protein
Product Sizes
10 ug
£133.00
RP01815-10UG
20 ug
£181.00
RP01815-20UG
50 ug
£240.00
RP01815-50UG
100 ug
£353.00
RP01815-100UG
About this Product
- SKU:
- RP01815
- Additional Names:
- 8D6|8D6A|CD320|sCD320|TCBLR|TCII-R|TCN2R
- Extra Details:
- Recombinant Human CD320 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser36-Val231) of human CD320 (Accession #NP_057663.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala31-Thr704
- Molecular Weight:
- 20.88 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01815
