Recombinant Human Neurogranin/NRGN Protein
Product Sizes
10 ug
£133.00
RP01814-10UG
20 ug
£181.00
RP01814-20UG
50 ug
£240.00
RP01814-50UG
100 ug
£353.00
RP01814-100UG
About this Product
- SKU:
- RP01814
- Additional Names:
- hng|Neurogranin|NRGN|RC3
- Extra Details:
- Recombinant Human Neurogranin/NRGN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp2-Asp78) of human NRGN/Neurogranin (Accession #) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris 150mM Nacl, pH 7.5.
- Immunogen:
- Asp2-Asp78
- Molecular Weight:
- 33.45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP01814
