Recombinant Mouse IL-36Ra/IL-1F5 Protein
Product Sizes
10 ug
£133.00
RP01809-10UG
20 ug
£181.00
RP01809-20UG
50 ug
£240.00
RP01809-50UG
100 ug
£353.00
RP01809-100UG
500 ug
£1002.00
RP01809-500UG
1000 ug
£1574.00
RP01809-1000UG
About this Product
- SKU:
- RP01809
- Additional Names:
- Fil1delta|If36rn|Il-1h3|IL-36Ra|Il1f5|Il1hy1
- Extra Details:
- Interleukin-1 family member 5 (IL-1F5), also known as interleukin 36 receptor antagonist (IL36RA), is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). IL-1F5 is a highly and specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). IL-1F5 could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist, and interleukin-1 receptor type I (IL-1R1), which is present in epithelial barriers and takes part in the local inflammatory response. It has been proved that IL-1F5 induces IL-4 mRNA and protein expression in glia in vitro and enhances hippocampal expression of IL-4 following intracerebroventricular injection. The inhibitory effect of IL-1F5 on LPS-induced IL-1B Beta is attenuated in cells from IL-4-defective mice. Experiment results suggest that IL-1F5 mediates anti-inflammatory effects through its ability to induce IL-4 production and that this is a consequence of its interaction with the orphan receptor, single Ig IL-1R-related molecule (SIGIRR)/TIR8, as the effects were not observed in SIGIRR-/- mice. In contrast to its effects in brain tissue, IL-1F5 did not attenuate LPS-induced changes, or up-regulated IL-4 in macrophages or dendritic cells, suggesting that the effect is confined to the brain.
- Formulation:
- Recombinant Mouse IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val3-Asp156) of mouse IL-36Ra/IL-1F5 (Accession #NP_062324.2) fused wi
- Immunogen:
- Val3-Asp156
- Molecular Weight:
- 16-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01809
