Recombinant Mouse IL-36Ra/IL-1F5 Protein
Product Sizes
10 ug
£133.00
RP01809-10UG
20 ug
£181.00
RP01809-20UG
50 ug
£240.00
RP01809-50UG
100 ug
£353.00
RP01809-100UG
About this Product
- SKU:
- RP01809
- Additional Names:
- Fil1delta|If36rn|Il-1h3|IL-36Ra|Il1f5|Il1hy1
- Extra Details:
- Recombinant Mouse IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val3-Asp156) of mouse IL-36Ra/IL-1F5 (Accession #NP_062324.2) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val3-Asp156
- Molecular Weight:
- 16.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01809
