Recombinant Human Chemerin/RARRES2 Protein
Product Sizes
10 ug
£133.00
RP01808-10UG
20 ug
£181.00
RP01808-20UG
50 ug
£240.00
RP01808-50UG
100 ug
£353.00
RP01808-100UG
500 ug
£1002.00
RP01808-500UG
1000 ug
£1574.00
RP01808-1000UG
About this Product
- SKU:
- RP01808
- Additional Names:
- HP10433|RARRES2|TIG2
- Extra Details:
- Retinoic acid receptor responder protein 2 (RARRES2) is a small secreted protein involved in multiple cancers, including adrenocortical carcinoma (ACC). Serum RARRES2 may be used as a novel prognostic marker for ACC. Retinoic acid receptor responder 2 (RARRES2) is transcriptionally downregulated in multiple cancer types. Previous studies suggested that it can serve as an immune-dependent tumor suppressor by acting as a chemoattractant to recruit anticancer immune cells expressing its receptor, the chemerin chemokine receptor 1 (CMKLR1), to sites of tumor. Mechanistically, RARRES2 overexpression in ACC cells inhibited Wnt/beta-catenin pathway activity by promoting beta-catenin phosphorylation and degradation, it also inhibited the phosphorylation of p38 mitogen-activated protein kinase. Thus RARRES2 is a novel tumor suppressor for ACC, which can function through an immune-independent mechanism.
- Formulation:
- Recombinant Human Chemerin/RARRES2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Ser157) of human RARRES2/TIG2 (Accession #) fused with hF
- Immunogen:
- Glu21-Ser157
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01808
