Recombinant Mouse IL-23A/IL-23 p19 Protein
Product Sizes
10 ug
£145.00
RP01806-10UG
20 ug
£193.00
RP01806-20UG
50 ug
£288.00
RP01806-50UG
100 ug
£431.00
RP01806-100UG
500 ug
£1240.00
RP01806-500UG
1000 ug
£1954.00
RP01806-1000UG
About this Product
- SKU:
- RP01806
- Additional Names:
- IL-23|Il23a|p19
- Extra Details:
- The heterodimeric cytokine interleukin-23 (IL-23 or IL23A/IL12B) is produced by dendritic cells and macrophages and promotes the proinflammatory and regenerative activities of T helper 17 (Th17) and innate lymphoid cells. A recent study has reported that IL-23 is also secreted by lung adenoma cells and generates an inflammatory and immune-suppressed stroma.
- Formulation:
- Recombinant Mouse IL-23A/IL-23 p19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Ala196) of mouse IL-23A (Accession #NP_112542.1) fused wi
- Immunogen:
- Ala21-Ala196
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01806
