Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
Product Sizes
10 ug
£133.00
RP01805-10UG
20 ug
£181.00
RP01805-20UG
50 ug
£240.00
RP01805-50UG
100 ug
£353.00
RP01805-100UG
500 ug
£1002.00
RP01805-500UG
1000 ug
£1574.00
RP01805-1000UG
About this Product
- SKU:
- RP01805
- Additional Names:
- CD153|CD30L|CD30LG|TNFSF8|TNLG3A
- Extra Details:
- CD30 ligand (CD30L), also known as CD153 and TNFSF8, is a membrane-associated glycoprotein belonging to the TNF superfamily and TNFR superfamily, and is a specific ligand for CD30/TNFRSF8 originally described as a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. CD30L is a type-II membrane glycoprotein expressed on activated T cells, stimulated monocyte-macrophages, granulocytes, eosinophils, and some Burkitt-like lymphoma cell lines. CD30L is capable of transducing signals through CD30 on different CD30+ lymphoma cell lines, and mediates pleiotropic biologic effects including cell proliferation, activation, differentiation, as well as cell death by apoptosis. CD30-CD30 ligand interaction has been suggested to have a pathophysiologic role in malignant lymphomas, particularly Hodgkin disease, large cell anaplastic lymphomas and Burkitt lymphomas, and is also involved in activation and functioning of the T cell-dependent immune response. Thus, CD153 and its receptor CD30 are regarded as therapeutic targets in hematologic malignancies, autoimmune and inflammatory diseases.
- Formulation:
- Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln63-Asp234) of human TNFSF8/CD30L (Accession #NP_0012
- Immunogen:
- Gln63-Asp234
- Molecular Weight:
- 30-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01805
