Recombinant Human Microtubule-associated protein tau/MAPT Protein
Product Sizes
10 ug
£145.00
RP01804-10UG
20 ug
£193.00
RP01804-20UG
50 ug
£264.00
RP01804-50UG
100 ug
£395.00
RP01804-100UG
500 ug
£1157.00
RP01804-500UG
1000 ug
£1812.00
RP01804-1000UG
About this Product
- SKU:
- RP01804
- Additional Names:
- DDPAC|FTDP-17|MAPTL|MSTD|MTBT1|MTBT2|PPND|PPP1R103|TAU|tau-40|Tau-PHF6
- Extra Details:
- Tau proteins are proteins that stabilize microtubules. They are abundant in neurons of the central nervous system and are less common elsewhere, but are also expressed at very low levels in CNS astrocytes and oligodendrocytes. When tau proteins are defective, and no longer stabilize microtubules properly, they can result in dementias such as Alzheimer's disease. Tau protein is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are mostly found in neurons compared to non-neuronal cells. One of tau's main functions is to modulate the stability of axonal microtubules. Other nervous system MAPs may perform similar functions, as suggested by tau knockout mice, who did not show abnormalities in brain development - possibly because of compensation in tau deficiency by other MAPs.
- Formulation:
- Recombinant Human Microtubule-associated protein tau/MAPT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln88-Arg230) of human Microtubule-assoc
- Immunogen:
- Gln88-Arg230
- Molecular Weight:
- 45-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01804
