Recombinant Mouse ALK-4/ACVR1B Protein
Product Sizes
10 ug
£127.00
RP01803-10UG
20 ug
£175.00
RP01803-20UG
50 ug
£240.00
RP01803-50UG
100 ug
£336.00
RP01803-100UG
About this Product
- SKU:
- RP01803
- Additional Names:
- 6820432J04|ActR-IB|ActRIB|Acvrlk4|ALK-4|Alk4|SKR2
- Extra Details:
- Recombinant Mouse ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu126) of mouse ALK-4/ACVR1B (Accession #NP_031421.1) fused with hFC tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Glu126
- Molecular Weight:
- 37.30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01803




