Recombinant Mouse ALK-4/ACVR1B Protein
Product Sizes
10 ug
£127.00
RP01803-10UG
20 ug
£175.00
RP01803-20UG
50 ug
£240.00
RP01803-50UG
100 ug
£336.00
RP01803-100UG
500 ug
£1002.00
RP01803-500UG
1000 ug
£1574.00
RP01803-1000UG
About this Product
- SKU:
- RP01803
- Additional Names:
- 6820432J04|ActR-IB|ActRIB|Acvrlk4|ALK-4|Alk4|SKR2
- Extra Details:
- ACVR1B (Activin A Receptor, type 1B), belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, and TGFB receptor subfamily. ALK-4/ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B. The known type II activin receptors include ActRII and ActRIIB, while the main type I activin receptor in mammalian cells is ALK-4 (ActRIB). In the presence of activin, type II and type I receptors form complexes whereby the type II receptors activate ALK-4 through phosphorylation. The activated ALK-4, in turn, transduces signals downstream by phosphorylation of its effectors, such as Smads, to regulate gene expression and affect cellular phenotype. ALK-4/ACVR1B is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination.
- Formulation:
- Recombinant Mouse ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu126) of mouse ALK-4/ACVR1B (Accession #NP_031421.1) fused w
- Immunogen:
- Met1-Glu126
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01803
