Recombinant Human WFDC2/HE4/WAP5 Protein
Product Sizes
10 ug
£133.00
RP01798-10UG
20 ug
£181.00
RP01798-20UG
50 ug
£240.00
RP01798-50UG
100 ug
£353.00
RP01798-100UG
500 ug
£1002.00
RP01798-500UG
1000 ug
£1574.00
RP01798-1000UG
About this Product
- SKU:
- RP01798
- Additional Names:
- dJ461P17.6|EDDM4|FLT-4|HE4|VEGFR-3|WAP5|WFDC2
- Extra Details:
- WAP four-disulfide core domain protein 2, also known as Epididymal secretory protein E4, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WFDC2 and HE4, is a secreted protein that contains two WAP domains. WFDC2 / HE4 is a member of a family of stable 4-disulfide core proteins that are secreted at high levels. It is expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. It is highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis. WFDC2 may be a component of the innate immune defences of the lung, nasal and oral cavities and suggest that WFDC2 functions in concert with related WAP domain containing proteins in epithelial host defence. WFDC2 re-expression in lung carcinomas may prove to be associated with tumour type and should be studied in further detail. Mammary gland expression of tammar WFDC2 during the course of lactation showed WFDC2 was elevated during pregnancy, reduced in early lactation and absent in mid-late lactation. WFDC2 / HE4 can undergo a complex series of alternative splicing events that can potentially yield five distinct WAP domain containing protein isoforms.
- Formulation:
- Recombinant Human WFDC2/HE4/WAP5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu31-Phe124) of human WFDC2/HE4/WAP5 (Accession #NP_006094.3) fu
- Immunogen:
- Glu31-Phe124
- Molecular Weight:
- 45-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01798
