Recombinant Human GHRL/MTLRP Protein
Product Sizes
10 ug
£133.00
RP01796-10UG
20 ug
£181.00
RP01796-20UG
50 ug
£240.00
RP01796-50UG
100 ug
£353.00
RP01796-100UG
500 ug
£1002.00
RP01796-500UG
1000 ug
£1574.00
RP01796-1000UG
About this Product
- SKU:
- RP01796
- Additional Names:
- GHRL|MTLRP
- Extra Details:
- Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility.
- Formulation:
- Recombinant Human GHRL/MTLRP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys117) of human GHRL/MTLRP (Accession #NP_001128413.1) fused w
- Immunogen:
- Gly24-Lys117
- Molecular Weight:
- 45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01796
